TNFRSF17 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10707P
Article Name: TNFRSF17 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10707P
Supplier Catalog Number: CNA10707P
Alternative Catalog Number: MBL-CNA10707P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TNFRSF17 (NP_001183.2).
Conjugation: Unconjugated
Alternative Names: BCM, BCMA, CD269, TNFRSF13A
Clonality: Polyclonal
Molecular Weight: 20kDa
NCBI: 608
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCLGLSLIISLAVFVLMFLLRKINSEPLKDEFKNTGSGLLGMA
Target: TNFRSF17
Application Dilute: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200