CSRP1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA1071S
Article Name: |
CSRP1 Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA1071S |
Supplier Catalog Number: |
CNA1071S |
Alternative Catalog Number: |
MBL-CNA1071S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
IP, WB |
Species Reactivity: |
Human, Mouse |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human CSRP1 (NP_004069.1). |
Conjugation: |
Unconjugated |
Alternative Names: |
CRP, CRP1, CSRP, CYRP, D1S181E, HEL-141, HEL-S-286 |
Clonality: |
Polyclonal |
Molecular Weight: |
21kDa |
NCBI: |
1465 |
Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,50% glycerol |
Sequence: |
MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE |
Target: |
CSRP1 |
Application Dilute: |
WB: WB,1:500 - 1:2000|IP,1:50 - 1:200|RIP,1:20 - 1:50 |