WHRN Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10773T
Article Name: WHRN Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10773T
Supplier Catalog Number: CNA10773T
Alternative Catalog Number: MBL-CNA10773T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 708-907 of human WHRN (NP_056219.3).
Conjugation: Unconjugated
Alternative Names: WI, CIP98, USH2D, DFNB31, PDZD7B
Clonality: Polyclonal
Molecular Weight: 97kDa
NCBI: 25861
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: PSGHPDQTGTNQHFVMVEVHRPDSEPDVNEVRALPQTRTASTLSQLSDSGQTLSEDSGVDAGEAEASAPGRGRQSVSTKSRSSKELPRNERPTDGANKPPGLLEPTSTLVRVKKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGHVILEVNGLTLRGKEHREAARIIAEAFKTKDRDYIDFLVTEFNVML
Target: WHRN
Application Dilute: WB: WB,1:500 - 1:2000