ZP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10776T
Article Name: ZP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10776T
Supplier Catalog Number: CNA10776T
Alternative Catalog Number: MBL-CNA10776T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 340-610 of human ZP1 (NP_997224.2).
Conjugation: Unconjugated
Alternative Names: OOMD, ZPB1, OOMD1, HEL163, OZEMA1
Clonality: Polyclonal
Molecular Weight: 70kDa
NCBI: 22917
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: AGDQLIYENWLVSGIHIQKGPQGSITRDSTFQLHVRCVFNASDFLPIQASIFPPPSPAPMTQPGPLRLELRIAKDETFSSYYGEDDYPIVRLLREPVHVEVRLLQRTDPNLVLLLHQCWGAPSANPFQQPQWPILSDGCPFKGDSYRTQMVALDGATPFQSHYQRFTVATFALLDSGSQRALRGLVYLFCSTSACHTSGLETCSTACSTGTTRQRRSSGHRNDTARPQDIVSSPGPVGFEDSYGQEPTLGPTDS
Target: ZP1
Application Dilute: WB: WB,1:500 - 1:2000