ARPC2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10791T
Article Name: ARPC2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10791T
Supplier Catalog Number: CNA10791T
Alternative Catalog Number: MBL-CNA10791T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human ARPC2 (NP_690601.1).
Conjugation: Unconjugated
Alternative Names: ARC34, PRO2446, p34-Arc, PNAS-139
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 10109
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYH
Target: ARPC2
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200