MTMR3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10806T
Article Name: MTMR3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10806T
Supplier Catalog Number: CNA10806T
Alternative Catalog Number: MBL-CNA10806T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 640-810 of human MTMR3 (NP_066576.1).
Conjugation: Unconjugated
Alternative Names: ZFYVE10, FYVE-DSP1
Clonality: Polyclonal
Molecular Weight: 134kDa
NCBI: 8897
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: KWQEHRRSLELSSLAGPGEDPLSADSLGKPTRVPGGAELSVAAGVAEGQMENILQEATKEESGVEEPAHRAGIEIQEGKEDPLLEKESRRKTPEASAIGLHQDPELGDAALRSHLDMSWPLFSQGISEQQSGLSVLLSSLQVPPRGEDSLEVPVEQFRIEEIAEGREEAVL
Target: MTMR3
Application Dilute: WB: WB,1:500 - 1:2000