p38 MAPK Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10832T
Article Name: p38 MAPK Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10832T
Supplier Catalog Number: CNA10832T
Alternative Catalog Number: MBL-CNA10832T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human p38 MAPK (NP_620581.1).
Conjugation: Unconjugated
Alternative Names: RK, p38, CSBP, EXIP, Mxi2, CSBP1, CSBP2, CSPB1, PRKM14, PRKM15, SAPK2A, p38ALPHA
Clonality: Polyclonal
Molecular Weight: 41kDa
NCBI: 1432
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: AQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Target: MAPK14
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200