IL22RA1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA10941S
Article Name: |
IL22RA1 Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA10941S |
Supplier Catalog Number: |
CNA10941S |
Alternative Catalog Number: |
MBL-CNA10941S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human, Mouse, Rat |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 16-230 of human IL22RA1 (NP_067081.2). |
Conjugation: |
Unconjugated |
Alternative Names: |
IL22R, CRF2-9, IL22R1 |
Clonality: |
Polyclonal |
Molecular Weight: |
63kDa |
NCBI: |
58985 |
Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,50% glycerol |
Sequence: |
HAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWTYS |
Target: |
IL22RA1 |
Application Dilute: |
WB: WB,1:100 - 1:500 |