IL22RA1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA10941S
| Article Name: |
IL22RA1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA10941S |
| Supplier Catalog Number: |
CNA10941S |
| Alternative Catalog Number: |
MBL-CNA10941S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 16-230 of human IL22RA1 (NP_067081.2). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
IL22R, CRF2-9, IL22R1 |
| Clonality: |
Polyclonal |
| Molecular Weight: |
63kDa |
| NCBI: |
58985 |
| Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequence: |
HAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWTYS |
| Target: |
IL22RA1 |
| Application Dilute: |
WB: WB,1:100 - 1:500 |
