TNFR2/TNFRSF1B Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA1095S
Article Name: |
TNFR2/TNFRSF1B Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA1095S |
Supplier Catalog Number: |
CNA1095S |
Alternative Catalog Number: |
MBL-CNA1095S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human, Mouse, Rat |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 400-461 of human TNFR2/TNFRSF1B (NP_001057.1). |
Conjugation: |
Unconjugated |
Alternative Names: |
p75, TBPII, TNFBR, TNFR2, CD120b, TNFR1B, TNFR80, TNF-R75, p75TNFR, TNF-R-II |
Clonality: |
Polyclonal |
Molecular Weight: |
48kDa |
NCBI: |
7133 |
Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,50% glycerol |
Sequence: |
QASSTMGDTDSSPSESPKDEQVPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPDAGMKPS |
Target: |
TNFRSF1B |
Application Dilute: |
WB: WB,1:500 - 1:1000 |