TNFR2/TNFRSF1B Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA1095S
| Article Name: |
TNFR2/TNFRSF1B Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA1095S |
| Supplier Catalog Number: |
CNA1095S |
| Alternative Catalog Number: |
MBL-CNA1095S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 400-461 of human TNFR2/TNFRSF1B (NP_001057.1). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
p75, TBPII, TNFBR, TNFR2, CD120b, TNFR1B, TNFR80, TNF-R75, p75TNFR, TNF-R-II |
| Clonality: |
Polyclonal |
| Molecular Weight: |
48kDa |
| NCBI: |
7133 |
| Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequence: |
QASSTMGDTDSSPSESPKDEQVPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPDAGMKPS |
| Target: |
TNFRSF1B |
| Application Dilute: |
WB: WB,1:500 - 1:1000 |
