Lysozyme (LYZ) Rabbit mAb, Clone: [ARC57153], Unconjugated, Monoclonal

Catalog Number: MBL-CNA10972P
Article Name: Lysozyme (LYZ) Rabbit mAb, Clone: [ARC57153], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA10972P
Supplier Catalog Number: CNA10972P
Alternative Catalog Number: MBL-CNA10972P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lysozyme (LYZ) (NP_000230.1).
Conjugation: Unconjugated
Alternative Names: LZM,LYZF1
Clonality: Monoclonal
Clone Designation: [ARC57153]
Molecular Weight: 17kDa
NCBI: 4069
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCS
Target: LYZ
Application Dilute: WB: WB,1:3000 - 1:20000|IHC-P,1:50 - 1:200