STK36 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA10974T
Article Name: |
STK36 Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA10974T |
Supplier Catalog Number: |
CNA10974T |
Alternative Catalog Number: |
MBL-CNA10974T |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Mouse |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 250-450 of human STK36 (NP_056505.2). |
Conjugation: |
Unconjugated |
Alternative Names: |
FU, CILD46 |
Clonality: |
Polyclonal |
Molecular Weight: |
144kDa |
NCBI: |
27148 |
Buffer: |
PBS with 0.01% thimerosal,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.01% thimerosal,50% glycerol |
Sequence: |
YHPFIAGHVTIITEPAGPDLGTPFTSRLPPELQVLKDEQAHRLAPKGNQSRILTQAYKRMAEEAMQKKHQNTGPALEQEDKTSKVAPGTAPLPRLGATPQESSLLAGILASELKSSWAKSGTGEVPSAPRENRTTPDCERAFPEERPEVLGQRSTDVVDLENEEPDSDNEWQHLLETTEPVPIQLKAPLTLLCNPDFCQRI |
Target: |
STK36 |
Application Dilute: |
WB: WB,1:500 - 1:1000 |