Smad1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1101S
Article Name: Smad1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1101S
Supplier Catalog Number: CNA1101S
Alternative Catalog Number: MBL-CNA1101S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-240 of human Smad1 (NP_001003688.1).
Conjugation: Unconjugated
Alternative Names: BSP1, JV41, BSP-1, JV4-1, MADH1, MADR1
Clonality: Polyclonal
Molecular Weight: 52kDa
NCBI: 4086
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: WKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQ
Target: SMAD1
Application Dilute: WB: WB,1:500 - 1:1000