Tau Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1103S
Article Name: Tau Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1103S
Supplier Catalog Number: CNA1103S
Alternative Catalog Number: MBL-CNA1103S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600 to the C-terminus of human Tau (NP_058519.3).
Conjugation: Unconjugated
Alternative Names: TAU, MSTD, PPND, DDPAC, MAPTL, MTBT1, MTBT2, tau-40, FTDP-17, PPP1R103, Tau-PHF6
Clonality: Polyclonal
Molecular Weight: 79kDa
NCBI: 4137
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: DLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
Target: MAPT
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:100 - 1:200|IF/ICC,1:50 - 1:200