CTGF Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11067P
Article Name: CTGF Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11067P
Supplier Catalog Number: CNA11067P
Alternative Catalog Number: MBL-CNA11067P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CTGF (NP_001892.2).
Conjugation: Unconjugated
Alternative Names: CTGF, NOV2, HCS24, IGFBP8
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 1490
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: GAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCL
Target: CCN2
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:20 - 1:50