AP2M1 Rabbit mAb, Clone: [ARC0522], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11070S
Article Name: AP2M1 Rabbit mAb, Clone: [ARC0522], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11070S
Supplier Catalog Number: CNA11070S
Alternative Catalog Number: MBL-CNA11070S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human AP2M1 (Q96CW1).
Conjugation: Unconjugated
Alternative Names: mu2, AP50, MRD60, CLAPM1
Clonality: Monoclonal
Clone Designation: [ARC0522]
Molecular Weight: 50kDa
NCBI: 1173
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: KLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLK
Target: AP2M1
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200