EpCAM Rabbit mAb, Clone: [ARC0521], Unconjugated, Monoclonal

Catalog Number: MBL-CNA1107S
Article Name: EpCAM Rabbit mAb, Clone: [ARC0521], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA1107S
Supplier Catalog Number: CNA1107S
Alternative Catalog Number: MBL-CNA1107S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human EpCAM (P16422).
Conjugation: Unconjugated
Alternative Names: ESA, KSA, M4S1, MK-1, DIAR5, EGP-2, EGP40, KS1/4, MIC18, TROP1, BerEp4, EGP314, HNPCC8, LYNCH8, MOC-31, Ber-Ep4, TACSTD1
Clonality: Monoclonal
Clone Designation: [ARC0521]
Molecular Weight: 35kDa
NCBI: 4072
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCD
Target: EPCAM
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200