Histone H2AX Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11097S
Article Name: Histone H2AX Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11097S
Supplier Catalog Number: CNA11097S
Alternative Catalog Number: MBL-CNA11097S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human Histone H2AX (NP_002096.1).
Conjugation: Unconjugated
Alternative Names: H2A.X, H2A/X, H2AFX
Clonality: Polyclonal
Molecular Weight: 15kDa
NCBI: 3014
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: VYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY
Target: H2AX
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200