Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11102P
Article Name: Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11102P
Supplier Catalog Number: CNA11102P
Alternative Catalog Number: MBL-CNA11102P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-265 of human Heme Oxygenase 1 (HO-1/HMOX1) (NP_002124.1).
Conjugation: Unconjugated
Alternative Names: HO-1, HSP32, HMOX1D, bK286B10
Clonality: Polyclonal
Molecular Weight: 33kDa
NCBI: 3162
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPR
Target: HMOX1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200