IL1RA Rabbit mAb, Clone: [ARC0524], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11103S
Article Name: IL1RA Rabbit mAb, Clone: [ARC0524], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11103S
Supplier Catalog Number: CNA11103S
Alternative Catalog Number: MBL-CNA11103S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human IL1RA (P18510).
Conjugation: Unconjugated
Alternative Names: DIRA, IRAP, IL1F3, IL1RA, MVCD4, IL-1RN, IL-1ra, IL-1ra3, ICIL-1RA
Clonality: Monoclonal
Clone Designation: [ARC0524]
Molecular Weight: 20kDa
Sensitivity: 0.17 mg/mL
NCBI: 3557
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: ETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Target: IL1RN
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200