PKC alpha Rabbit mAb, Clone: [ARC0197], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11107S
Article Name: PKC alpha Rabbit mAb, Clone: [ARC0197], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11107S
Supplier Catalog Number: CNA11107S
Alternative Catalog Number: MBL-CNA11107S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 573-672 of human PKC alpha (P17252).
Conjugation: Unconjugated
Alternative Names: AAG6, PKCA, PRKACA, PKCI+/-, PKCalpha, PKC-alpha
Clonality: Monoclonal
Clone Designation: [ARC0197]
Molecular Weight: 77kDa
Sensitivity: 0.26 mg/mL
NCBI: 5578
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV
Target: PRKCA
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IP,1:50 - 1:200