IGFBP1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA11109P
| Article Name: |
IGFBP1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA11109P |
| Supplier Catalog Number: |
CNA11109P |
| Alternative Catalog Number: |
MBL-CNA11109P |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 81-259 of human IGFBP1 (NP_000587.1). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
AFBP, IBP1, PP12, IGF-BP25, hIGFBP-1 |
| Clonality: |
Polyclonal |
| Molecular Weight: |
28kDa |
| NCBI: |
3484 |
| Buffer: |
PBS with 0.05% proclin300,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.05% proclin300,50% glycerol |
| Sequence: |
GLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN |
| Target: |
IGFBP1 |
| Application Dilute: |
WB: WB,1:500 - 1:1000 |
