CYR61 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1111P
Article Name: CYR61 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1111P
Supplier Catalog Number: CNA1111P
Alternative Catalog Number: MBL-CNA1111P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 120-220 of human CYR61 (NP_001545.2).
Conjugation: Unconjugated
Alternative Names: GIG1, CYR61, IGFBP10
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 3491
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: QCTCIDGAVGCIPLCPQELSLPNLGCPNPRLVKVTGQCCEEWVCDEDSIKDPMEDQDGLLGKELGFDASEVELTRNNELIAVGKGSSLKRLPVFGMEPRIL
Target: CCN1
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200