VEGF Receptor 2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11127S
Article Name: VEGF Receptor 2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11127S
Supplier Catalog Number: CNA11127S
Alternative Catalog Number: MBL-CNA11127S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1147-1356 of human VEGF Receptor 2 (NP_002244.1).
Conjugation: Unconjugated
Alternative Names: FLK1, CD309, VEGFR, VEGFR2
Clonality: Polyclonal
Molecular Weight: 152kDa
NCBI: 3791
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: PSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVSCMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDSGMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYSSEEAELLKLIEIGVQTGSTAQILQPDSGTTLSSPPV
Target: KDR
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200