[KO Validated] CDK4 Rabbit mAb, Clone: [ARC51004], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA11136P
| Article Name: |
[KO Validated] CDK4 Rabbit mAb, Clone: [ARC51004], Unconjugated, Monoclonal |
| Biozol Catalog Number: |
MBL-CNA11136P |
| Supplier Catalog Number: |
CNA11136P |
| Alternative Catalog Number: |
MBL-CNA11136P |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC-P, WB |
| Species Reactivity: |
Human, Monkey, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 204-303 of human CDK4 (NP_000066.1). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
CMM3, PSK-J3 |
| Clonality: |
Monoclonal |
| Clone Designation: |
[ARC51004] |
| Molecular Weight: |
34kDa |
| NCBI: |
1019 |
| Buffer: |
PBS with 0.05% proclin300,0.05% BSA,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.05% proclin300,0.05% BSA,50% glycerol |
| Sequence: |
FAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE |
| Target: |
CDK4 |
| Application Dilute: |
WB: WB,1:500 - 1:1000|IHC-P,1:100 - 1:500 |
