[KO Validated] CDK9 Rabbit mAb, Clone: [ARC0527], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11145S
Article Name: [KO Validated] CDK9 Rabbit mAb, Clone: [ARC0527], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11145S
Supplier Catalog Number: CNA11145S
Alternative Catalog Number: MBL-CNA11145S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ChIP, ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 273-372 of human CDK9 (P50750).
Conjugation: Unconjugated
Alternative Names: TAK, C-2k, CTK1, CDC2L4, PITALRE
Clonality: Monoclonal
Clone Designation: [ARC0527]
Molecular Weight: 43kDa
NCBI: 1025
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: RKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF
Target: CDK9
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000|ChIP,1:50 - 1:200|ChIP-seq,2-4µg/IP|CUT&Tag, 105 cells /5 µg