MMP13 Rabbit mAb, Clone: [ARC0528], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11148S
Article Name: MMP13 Rabbit mAb, Clone: [ARC0528], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11148S
Supplier Catalog Number: CNA11148S
Alternative Catalog Number: MBL-CNA11148S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human MMP13 (P45452).
Conjugation: Unconjugated
Alternative Names: CLG3, MDST, MANDP1, MMP-13
Clonality: Monoclonal
Clone Designation: [ARC0528]
Molecular Weight: 54kDa
NCBI: 4322
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: RGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQF
Target: MMP13
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200