MRP1/ABCC1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11153S
Article Name: MRP1/ABCC1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11153S
Supplier Catalog Number: CNA11153S
Alternative Catalog Number: MBL-CNA11153S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 850-960 of human MRP1/ABCC1 (NP_004987.2).
Conjugation: Unconjugated
Alternative Names: MRP, ABCC, GS-X, MRP1, ABC29, DFNA77
Clonality: Polyclonal
Molecular Weight: 172kDa
NCBI: 4363
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: GSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKL
Target: ABCC1
Application Dilute: WB: WB,1:500 - 1:2000