MTCO2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11154S
Article Name: MTCO2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11154S
Supplier Catalog Number: CNA11154S
Alternative Catalog Number: MBL-CNA11154S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of mouse MTCO2 (NP_904331.1).
Conjugation: Unconjugated
Alternative Names: COX2
Clonality: Polyclonal
Molecular Weight: 26kDa
NCBI: 17709
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MGHQWYWSYEYTDYEDLCFDSYMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATVTSNRPGLFYGQCSEIC
Target: mt-Co2
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:500|IF/ICC,1:50 - 1:200