CD3H Rabbit mAb, Clone: [ARC0533], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11157S
Article Name: CD3H Rabbit mAb, Clone: [ARC0533], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11157S
Supplier Catalog Number: CNA11157S
Alternative Catalog Number: MBL-CNA11157S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: FC, IHC-P, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 65-164 of human CD3H (P20963).
Conjugation: Unconjugated
Alternative Names: T3Z, CD3H, CD3Q, CD3Z, TCRZ, IMD25, CD3ZETA, CD3-ZETA
Clonality: Monoclonal
Clone Designation: [ARC0533]
Molecular Weight: 19kDa
NCBI: 919
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: QQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Target: CD247
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|FC,1:50 - 1:200