NFKB1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11160T
Article Name: NFKB1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11160T
Supplier Catalog Number: CNA11160T
Alternative Catalog Number: MBL-CNA11160T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 41-365 of NFKB1 (NP_001158884.1).
Conjugation: Unconjugated
Alternative Names: KBF1, EBP-1, NF-kB, CVID12, NF-kB1, NFKB-p50, NFkappaB, NF-kappaB, NFKB-p105, NF-kappa-B1, NF-kappabeta
Clonality: Polyclonal
Molecular Weight: 105kDa
NCBI: 4790
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: GPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVW
Target: NFKB1
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:20 - 1:100|IP,1:20 - 1:50