Myelin Basic Protein Rabbit mAb, Clone: [ARC0535], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11162S
Article Name: Myelin Basic Protein Rabbit mAb, Clone: [ARC0535], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11162S
Supplier Catalog Number: CNA11162S
Alternative Catalog Number: MBL-CNA11162S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 161-304 of human Myelin Basic Protein (P02686).
Conjugation: Unconjugated
Alternative Names: MBP, myelin basic protein
Clonality: Monoclonal
Clone Designation: [ARC0535]
Molecular Weight: 33kDa
NCBI: 4155
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: GFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARR
Target: MBP
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200