NF-kappaB2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11163S
Article Name: NF-kappaB2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11163S
Supplier Catalog Number: CNA11163S
Alternative Catalog Number: MBL-CNA11163S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 690-899 of human NF-kappaB2 (NP_002493.3).
Conjugation: Unconjugated
Alternative Names: p52, p100, H2TF1, LYT10, CVID10, LYT-10, NF-kB2, p49/p100
Clonality: Polyclonal
Molecular Weight: 97kDa
NCBI: 4791
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: AGADIHAENEEPLCPLPSPPTSDSDSDSEGPEKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH
Target: NFKB2
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200