PPARgamma Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11183T
Article Name: PPARgamma Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11183T
Supplier Catalog Number: CNA11183T
Alternative Catalog Number: MBL-CNA11183T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human PPARgamma (NP_056953.2).
Conjugation: Unconjugated
Alternative Names: GLM1, CIMT1, NR1C3, PPARG1, PPARG2, PPARG5, PPARgamma
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 5468
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKT
Target: PPARG
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:100 - 1:500