FAK Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11195P
Article Name: FAK Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11195P
Supplier Catalog Number: CNA11195P
Alternative Catalog Number: MBL-CNA11195P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 734-834 of human FAK (NP_722560.1).
Conjugation: Unconjugated
Alternative Names: FAK, FADK, FAK1, FRNK, FADK 1, PPP1R71, p125FAK, pp125FAK
Clonality: Polyclonal
Molecular Weight: 119kDa
NCBI: 5747
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: QHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLK
Target: PTK2
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:50 - 1:100