Complement C3 Rabbit mAb, Clone: [ARC0541], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA11196S
| Article Name: |
Complement C3 Rabbit mAb, Clone: [ARC0541], Unconjugated, Monoclonal |
| Biozol Catalog Number: |
MBL-CNA11196S |
| Supplier Catalog Number: |
CNA11196S |
| Alternative Catalog Number: |
MBL-CNA11196S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human Complement Complement C3 (P01024). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
ASP, C3a, C3b, AHUS5, ARMD9, CPAMD1, HEL-S-62p |
| Clonality: |
Monoclonal |
| Clone Designation: |
[ARC0541] |
| Molecular Weight: |
187kDa |
| NCBI: |
718 |
| Buffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Sequence: |
GRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAPDHQELNLDVSLQL |
| Target: |
C3 |
| Application Dilute: |
WB: WB,1:500 - 1:1000 |
