Galectin 3/LGALS3 Rabbit mAb, Clone: [ARC0542], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11198S
Article Name: Galectin 3/LGALS3 Rabbit mAb, Clone: [ARC0542], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11198S
Supplier Catalog Number: CNA11198S
Alternative Catalog Number: MBL-CNA11198S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Galectin 3/LGALS3 (P17931).
Conjugation: Unconjugated
Alternative Names: L31, GAL3, MAC2, CBP35, GALBP, GALIG, LGALS2
Clonality: Monoclonal
Clone Designation: [ARC0542]
Molecular Weight: 26kDa
NCBI: 3958
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGA
Target: LGALS3
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IP,1:100 - 1:500