NF-kB p65/RelA Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11204P
Article Name: NF-kB p65/RelA Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11204P
Supplier Catalog Number: CNA11204P
Alternative Catalog Number: MBL-CNA11204P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human NF-kB p65/RelA (NP_068810.3).
Conjugation: Unconjugated
Alternative Names: p65, CMCU, NFKB3, AIF3BL3
Clonality: Polyclonal
Molecular Weight: 60kDa
NCBI: 5970
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: YEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVN
Target: RELA
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000