GLUT1/SLC2A1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11208T
Article Name: GLUT1/SLC2A1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11208T
Supplier Catalog Number: CNA11208T
Alternative Catalog Number: MBL-CNA11208T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human GLUT1/SLC2A1 (NP_006507.2).
Conjugation: Unconjugated
Alternative Names: CSE, PED, DYT9, GLUT, DYT17, DYT18, EIG12, GLUT1, HTLVR, GLUT-1, SDCHCN, GLUT1DS
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 6513
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: RPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADSQV
Target: SLC2A1
Application Dilute: WB: WB,1:500 - 1:2000