ATPB Rabbit mAb, Clone: [ARC53533], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11214P
Article Name: ATPB Rabbit mAb, Clone: [ARC53533], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11214P
Supplier Catalog Number: CNA11214P
Alternative Catalog Number: MBL-CNA11214P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 230-529 of human ATPB (NP_001677.2).
Conjugation: Unconjugated
Alternative Names: ATP5B, ATPMB, ATPSB, HUMOP2, HEL-S-271
Clonality: Monoclonal
Clone Designation: [ARC53533]
Molecular Weight: 57kDa
NCBI: 506
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: YSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVP
Target: ATP5F1B
Application Dilute: WB: WB,1:3000 - 1:20000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200