STAT3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11216P
Article Name: STAT3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11216P
Supplier Catalog Number: CNA11216P
Alternative Catalog Number: MBL-CNA11216P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600-700 of human STAT3 (NP_003141.2).
Conjugation: Unconjugated
Alternative Names: APRF, HIES, ADMIO, ADMIO1
Clonality: Polyclonal
Molecular Weight: 88kDa
NCBI: 6774
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: TKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPG
Target: STAT3
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200