Ku70 Rabbit mAb, Clone: [ARC0551], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11223S
Article Name: Ku70 Rabbit mAb, Clone: [ARC0551], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11223S
Supplier Catalog Number: CNA11223S
Alternative Catalog Number: MBL-CNA11223S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-609 of human Ku70 (P12956).
Conjugation: Unconjugated
Alternative Names: ML8, KU70, TLAA, CTC75, CTCBF, G22P1
Clonality: Monoclonal
Clone Designation: [ARC0551]
Molecular Weight: 70kDa
NCBI: 2547
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: PEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD
Target: XRCC6
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200