TLR2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11225S
Article Name: TLR2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11225S
Supplier Catalog Number: CNA11225S
Alternative Catalog Number: MBL-CNA11225S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600-700 of human TLR2 (NP_003255.2).
Conjugation: Unconjugated
Alternative Names: TIL4, CD282
Clonality: Polyclonal
Molecular Weight: 90kDa
NCBI: 7097
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: LLILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTV
Target: TLR2
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200