p53 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11232S
Article Name: p53 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11232S
Supplier Catalog Number: CNA11232S
Alternative Catalog Number: MBL-CNA11232S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 95-390 of mouse p53 (NP_035770.2).
Conjugation: Unconjugated
Alternative Names: bbl, bfy, bhy, p44, p53, Tp53
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 22059
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: PSQKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELK
Target: Trp53
Application Dilute: WB: IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200