G6PD Rabbit mAb, Clone: [ARC0553], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA11234S
| Article Name: |
G6PD Rabbit mAb, Clone: [ARC0553], Unconjugated, Monoclonal |
| Biozol Catalog Number: |
MBL-CNA11234S |
| Supplier Catalog Number: |
CNA11234S |
| Alternative Catalog Number: |
MBL-CNA11234S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 400-500 of human G6PD (P11413). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
G6PD1 |
| Clonality: |
Monoclonal |
| Clone Designation: |
[ARC0553] |
| Molecular Weight: |
59kDa |
| NCBI: |
2539 |
| Buffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Sequence: |
VYTKMMTKKPGMFFNPEESELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKPKPIPYIYGSRGPTEADELMKRVG |
| Target: |
G6PD |
| Application Dilute: |
WB: WB,1:500 - 1:2000 |
