Annexin A2 Rabbit mAb, Clone: [ARC0554], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11235S
Article Name: Annexin A2 Rabbit mAb, Clone: [ARC0554], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11235S
Supplier Catalog Number: CNA11235S
Alternative Catalog Number: MBL-CNA11235S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Annexin A2 (P07355).
Conjugation: Unconjugated
Alternative Names: P36, ANX2, LIP2, LPC2, CAL1H, LPC2D, ANX2L4, PAP-IV, HEL-S-270
Clonality: Monoclonal
Clone Designation: [ARC0554]
Molecular Weight: 39kDa
NCBI: 302
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVIL
Target: ANXA2
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200