APEX1/APE1 Rabbit mAb, Clone: [ARC0556], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11238S
Article Name: APEX1/APE1 Rabbit mAb, Clone: [ARC0556], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11238S
Supplier Catalog Number: CNA11238S
Alternative Catalog Number: MBL-CNA11238S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human APEX1/APE1 (P27695).
Conjugation: Unconjugated
Alternative Names: APE, APX, APE1, APEN, APEX, HAP1, REF1
Clonality: Monoclonal
Clone Designation: [ARC0556]
Molecular Weight: 36kDa
Sensitivity: 0.26 mg/mL
NCBI: 328
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCS
Target: APEX1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200