[KD Validated] GPX4 Rabbit mAb, Clone: [ARC0558], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA11243S
Article Name: |
[KD Validated] GPX4 Rabbit mAb, Clone: [ARC0558], Unconjugated, Monoclonal |
Biozol Catalog Number: |
MBL-CNA11243S |
Supplier Catalog Number: |
CNA11243S |
Alternative Catalog Number: |
MBL-CNA11243S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human, Mouse, Rat |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GPX4 (P36969). |
Conjugation: |
Unconjugated |
Alternative Names: |
MCSP, SMDS, GPx-4, PHGPx, snGPx, GSHPx-4, snPHGPx |
Clonality: |
Monoclonal |
Clone Designation: |
[ARC0558] |
Molecular Weight: |
22kDa |
NCBI: |
2879 |
Buffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Sequence: |
MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAF |
Target: |
GPX4 |
Application Dilute: |
WB: WB,1:500 - 1:1000 |