SQSTM1/p62 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11246T
Article Name: SQSTM1/p62 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11246T
Supplier Catalog Number: CNA11246T
Alternative Catalog Number: MBL-CNA11246T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-440 of human SQSTM1/p62 (NP_003891.1).
Conjugation: Unconjugated
Alternative Names: p60, p62, A170, DMRV, OSIL, PDB3, ZIP3, p62B, NADGP, FTDALS3
Clonality: Polyclonal
Molecular Weight: 48kDa
NCBI: 8878
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNVGESVAAALSPLGIE
Target: SQSTM1
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200