SQSTM1/p62 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA11247P
| Article Name: |
SQSTM1/p62 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA11247P |
| Supplier Catalog Number: |
CNA11247P |
| Alternative Catalog Number: |
MBL-CNA11247P |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 341-440 of human SQSTM1/p62 (NP_003891.1). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
p60, p62, A170, DMRV, OSIL, PDB3, ZIP3, p62B, NADGP, FTDALS3 |
| Clonality: |
Polyclonal |
| Molecular Weight: |
48kDa |
| NCBI: |
8878 |
| Buffer: |
PBS with 0.05% proclin300,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.05% proclin300,50% glycerol |
| Sequence: |
LSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPPPL |
| Target: |
SQSTM1 |
| Application Dilute: |
WB: WB,1:500 - 1:2000 |
