SERPINC1 Rabbit mAb, Clone: [ARC0559], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11249S
Article Name: SERPINC1 Rabbit mAb, Clone: [ARC0559], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11249S
Supplier Catalog Number: CNA11249S
Alternative Catalog Number: MBL-CNA11249S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SERPINC1 (P01008).
Conjugation: Unconjugated
Alternative Names: AT3, AT3D, ATIII, THPH7, ATIII-R2, ATIII-T1, ATIII-T2
Clonality: Monoclonal
Clone Designation: [ARC0559]
Molecular Weight: 58kDa
NCBI: 462
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MYSNVIGTVTSGKRKVYLLSLLLIGFWDCVTCHGSPVDICTAKPRDIPMNPMCIYRSPEKKATEDEGSEQKIPEATNRRVWELSKANSRFATTFYQHLAD
Target: SERPINC1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200